accessibility menu, dialog, popup

UserName
Viewing profile as user:

Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.
All Primary Antibodies (1,896,162)
Primary Antibody Matched Pairs (7,119)
Protein Interaction Antibody Pairs (1,377)
Protein Phosphorylation Antibody Pairs (72)

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Narrow Results

category

special offers

  • (1)
  • (4)
  • (1)

brands

  • (2)
  • (1)
  • (1)
  • (28)
  • (2)
  • (2)
  • (967)
  • (76,152)
  • (14,164)
  • (39)
  • (6)
  • (59,912)
  • (1)
  • (110)
  • (258)
  • (2)
  • (1,310)
  • (574)
  • (2)
  • (1)
  • (11)
  • (1)
  • (1)
  • (24)
  • (1)
  • (4)
  • (4)
  • (1)
  • (13)
  • (1)
  • (2)
  • (24)
  • (2)
  • (4)
  • (1)
  • (1)
  • (10,631)
  • (397)
  • (1)
  • (12)
  • (1)
  • (8)
  • (3)
  • (2)
  • (1)
  • (1)
  • (190)
  • (52)
  • (1)
  • (6)
  • (1)
  • (63)
  • (3)
  • (15)
  • (1)
  • (12)
  • (2)
  • (1)
  • (76)
  • (5)
  • (17)
  • (19)
  • (1)
  • (14,087)
  • (2)
  • (1)
  • (1)
  • (32,178)
  • (82)
  • (468)
  • (2)
  • (1)
  • (11,561)
  • (1)
  • (1)
  • (51)
  • (3,044)
  • (6)
  • (470)
  • (104)
  • (22,741)
  • (1)
  • (4,434)
  • (1)
  • (1)
  • (1)
  • (1)
  • (16,240)
  • (1)
  • (76)
  • (18,946)
  • (139)
  • (203)
  • (3)
  • (2)
  • (62)
  • (1)
  • (1)
  • (2)
  • (26)
  • (5)
  • (1)
  • (3)
  • (10)
  • (415)
  • (2)
  • (13,812)
  • (28)
  • (1)
  • (2)
  • (45)
  • (41)
  • (11,435)
  • (1)
  • (2)
  • (8)
  • (6)
  • (2)
  • (20)
  • (2)
  • (2)
  • (54)
  • (1)
  • (2)
  • (12)
  • (20)
  • (1)
  • (34)
  • (2)
  • (1)
  • (40)
  • (2)
  • (1)
  • (62)
  • (53)
  • (453)
  • (55)
  • (10)
  • (3)
  • (77)
  • (12)
  • (11)
  • (1,195)
  • (8)
  • (9)
  • (1)
  • (20)
  • (11)
  • (1)
  • (23)
  • (3)
  • (1)
  • (3)
  • (5)
  • (2)
  • (59)
  • (92)
  • (1)
  • (1)
  • (170)
  • (204)
  • (4)
  • (127)
  • (2)
  • (1)
  • (691)
  • (13)
  • (912)
  • (1)
  • (102)
  • (2,102)
  • (114)
  • (2,514)
  • (1)
  • (12)
  • (1)
  • (1)
  • (970)
  • (1)
  • (1)
  • (1)
  • (2)
  • (6)
  • (118)
  • (1)
  • (63)
  • (3)
  • (2)
  • (3)
  • (1)
  • (1)
  • (8)
  • (1)
  • (291)
  • (1)
  • (1,813)
  • (2)
  • (1)
  • (12)
  • (3)
  • (1)
  • (1)
  • (1)
  • (1)
  • (14)
  • (6)
  • (16)
  • (1)
  • (23)
  • (11)
  • (12)
  • (2)
  • (1)
  • (2)
  • (2)
  • (143)
  • (33)
  • (1)
  • (41)
  • (1)
  • (19)
  • (3)
  • (4)
  • (1)
  • (1)
  • (5)
  • (1)
  • (2)
  • (158,071)
  • (53)
  • (2)
  • (3)
  • (3)
  • (133)
  • (1)
  • (1)
  • (9)
  • (1)
  • (117)
  • (1)
  • (2)
  • (4)
  • (185)
  • (1,154)
  • (10)
  • (2)
  • (10)
  • (8)
  • (2)
  • (4)
  • (1)
  • (1)
  • (1)
  • (112)
  • (12,113)
  • (680)
  • (164)
  • (1)
  • (6)
  • (1)
  • (8,394)
  • (1)
  • (16,428)
  • (3)
  • (5)
  • (4)
  • (137)
  • (31)
  • (107)
  • (1)
  • (3)
  • (8)
  • (6)
  • (9)
  • (3)
  • (2)
  • (1)
  • (1)
  • (1)
  • (2)
  • (2)
  • (1)
  • (12)
  • (1)
  • (1)
  • (30,469)
  • (13)
  • (1)
  • (32)
  • (1)
  • (1)
  • (79)
  • (1)
  • (1)
  • (11)
  • (7)
  • (1)
  • (2)
  • (1)
  • (1)
  • (1)
  • (2)
  • (24)
  • (40,282)
  • (2)
  • (1)
  • (11,792)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (39)
  • (7)
  • (55)
  • (15)
  • (1,256,816)
  • (3)
  • (1)
  • (5)
  • (16)
  • (4)
  • (1)
  • (28)
  • (548)
  • (1)
  • (11)
  • (2,474)
  • (2)
  • (1)
  • (4)
  • (2)
  • (2)
  • (416)
  • (1)
  • (8)
  • (4)
  • (1)
  • (1)
  • (4)
  • (1)
  • (1,426)
  • (136)
  • (1)
  • (1)
  • (1)
  • (553)
  • (26)
  • (19,235)
  • (1)
  • (8)
  • (1)
  • (1)
  • (1,795)
  • (2)
  • (3)
  • (5)
  • (3)
  • (700)
  • (2)
  • (1)
  • (3)
  • (1)
  • (8)
  • (1)
  • (1)
  • (5)
  • (39)
  • (1)
  • (4)
  • (1)
  • (1)
  • (6)
  • (1)
  • (2)
  • (380)
  • (8)
  • (1)
  • (39)
  • (2)
  • (9)
  • (1)
  • (1)
  • (1)
  • (2)
  • (2)
  • (8)
  • (5)
  • (1)
  • (14)
  • (1)
  • (1)
  • (28)
  • (235)
  • (1)
  • (3)
  • (2)
  • (17)
  • (1)
  • (1)
  • (10)
  • (10)
  • (2)
  • (1)
  • (2)
  • (40)
  • (7)

special interests

  • (154)
  • (13,719)
  • (165,544)
  • (73)
  • (70,490)

Quantity

  • (1)
  • (7)
  • (2)
  • (3,051)
  • (925)
  • (1,948)
  • (4,450)
Show all

Conjugate

  • (3)
  • (3)
  • (31,406)
  • (9)
  • (1)
  • (29)
  • (2,898)
Show all

Host Species

  • (565)
  • (2,897)
  • (51)
  • (1)
  • (15)
  • (1,898)
  • (726)
Show all

Regulatory Status

  • (336)
  • (964)
  • (1,700,159)

Applications

  • (983)
  • (2)
  • (36)
  • (23)
  • (193)
  • (1,232)
  • (3)
Show all

Target Species

  • (79)
  • (3)
  • (2)
  • (90)
  • (40)
  • (106)
  • (492)
Show all

Classification

  • (81)
  • (105)
  • (898,472)
  • (3,641)
  • (5)
  • (761,805)
  • (30,405)
Show all

Isotype

  • (2)
  • (1)
  • (2)
  • (1)
  • (1)
  • (1)
  • (6)
Show all

Form

  • (2,703)
  • (2,164)
  • (1,630)
  • (14)
  • (9)
  • (21)
  • (424,207)
Show all

Molecular Weight (g/mol)

  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
Show all

Search Within Results
Keyword Search:
5,761 – 5,775 of 1,824,471 results
5,761

Invitrogen™ GNAT1 Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

EDGE
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human,Mouse
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry (Frozen),Western Blot
Form Liquid
Gene Accession No. P11488, P20612
Isotype IgG
Concentration 1.34 mg/mL
Antigen GNAT1
Gene Symbols GNAT1
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias CSNB1G; CSNBAD3; G protein subunit alpha transducin 1; GBT1; Gnat1; Gnat-1; GNATR; guanine nucleotide binding protein (G protein), alpha transducing 1; guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 1; guanine nucleotide binding protein, alpha transducing 1; guanine nucleotide-binding protein G(t) subunit alpha-1; guanine nucleotide-binding protein G(T), alpha-1 subunit; Ird1; Ird2; irdc; irdr; rod-type transducin alpha subunit; Tr alpha; Tralpha; transducin; transducin alpha subunit; transducin alpha-1 chain; transducin alpha-subunit; transducin, rod-specific; transducin-alpha
Gene GNAT1
Product Type Antibody
Gene ID (Entrez) 14685, 2779
Formulation PBS with 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen Recombinant protein encompassing a sequence within the center region of human GNAT1. The exact sequence is proprietary.
Classification Polyclonal
Primary or Secondary Primary
5,762

CD30 Monoclonal Antibody (Ber-H2), Super Bright™ 702, eBioscience™, Invitrogen™
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Human
Host Species Mouse
Conjugate Super Bright 702
Applications Flow Cytometry
Form Liquid
Isotype IgG1 κ
Gene Accession No. P28908
Concentration 5 μL/Test
Antigen CD30
Gene Symbols TNFRSF8
Regulatory Status RUO
Purification Method Affinity chromatography
Gene TNFRSF8
Product Type Antibody
Gene ID (Entrez) 943
Formulation PBS with BSA and 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone Ber-H2
5,763

Invitrogen™ CD79b (Polatuzumab Biosimilar) Recombinant Human Monoclonal Antibody
GREENER_CHOICE

Human Recombinant Monoclonal Antibody

EDGE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Target Species Human
Host Species Human
Conjugate Unconjugated
Applications ELISA,SDS-Page
Form Liquid
Gene Accession No. P40259
Isotype IgG1 κ
Concentration 1.9 mg/mL
Antigen CD79b (Polatuzumab Biosimilar)
Gene Symbols Cd79b
Regulatory Status RUO
Purification Method Protein A/G
Gene Alias AGM6; B29; B-cell antigen receptor complex-associated protein beta chain; B-cell-specific glycoprotein B29; CD79; CD79b; CD79B antigen; CD79b molecule; Cd79b molecule, immunoglobulin-associated beta; Ig beta; IGB; Igbeta; Ig-beta; Immunoglobulin-associated B29 protein; immunoglobulin-associated beta; RP23-418O11.7
Gene Cd79b
Product Type Antibody
Gene ID (Entrez) 974
Formulation PBS with no preservative; pH 7.4
Immunogen Human CD79B(CD79b, B29, IGB, Ig-beta).
Classification Recombinant Monoclonal
Primary or Secondary Primary
5,764

Invitrogen™ BATF Recombinant Mouse Monoclonal Antibody (MBM7C7), Alexa Fluor™ Plus 488

Mouse Recombinant Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Human
Host Species Mouse
Conjugate Alexa Fluor Plus 488
Applications Flow Cytometry
Form Liquid
Gene Accession No. Q16520
Isotype IgG1 κ
Concentration 1 mg/mL
Antigen BATF
Gene Symbols Batf
Regulatory Status RUO
Purification Method Protein A/G
Gene Alias activating transcription factor B; basic leucine zipper ATF-like transcription factor; basic leucine zipper transcription factor, ATF-like; basic leucine zipper transcription factor-like; basic leucine zipper transcriptional factor ATF-like; BATF; B-ATF; BATF1; B-cell activating transcription factor; B-cell-activating transcription factor; SFA2; SFA-2; SF-HT-activated gene 2 protein; si:ch211-153j24.4
Gene Batf
Product Type Antibody
Gene ID (Entrez) 10538
Formulation Proprietary buffer with 0.008% Bromonitrodioxane, 0.008% Methylisothiazolone; pH 6.3-7.3
Classification Recombinant Monoclonal
Primary or Secondary Primary
Clone MBM7C7
5,765

Invitrogen™ Influenza A PB1 Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

EDGE
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Virus
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Immunocytochemistry
Form Liquid
Isotype IgG
Concentration 0.11 mg/mL
Antigen Influenza A PB1
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias Influenza PB1
Product Type Antibody
Formulation PBS with 1% BSA, 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen Recombinant protein encompassing a sequence within the N-terminus region of Influenza A virus PB1 (A/Puerto Rico/8/1934(H1N1)). The exact sequence is proprietary.
Classification Polyclonal
Primary or Secondary Primary
5,766

Invitrogen™ SHP2 Monoclonal Antibody (2E6)
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE
Content And Storage -20°C
Target Species Human,Mouse,Rat
Host Species Mouse
Conjugate Unconjugated
Applications Flow Cytometry,Immunocytochemistry,Immunohistochemistry (Paraffin),Western Blot
Form Lyophilized
Gene Accession No. P35235, P41499, Q06124
Isotype IgG2b
Concentration 500 μg/mL
Antigen SHP2
Gene Symbols PTPN11
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias 2700084A17Rik; AW536184; bptp3; CFC; cSH-PTP2; encodes catalytic domain; HCP; HGNC:9644; JMML; METCDS; MGC14433; Noonan syndrome 1; ns1; null; OTTHUMP00000166108; phosphotyrosyl-protein phosphatase; protein tyrosine phosphatase non-receptor type 11; protein tyrosine phosphatase SH-PTP2; protein tyrosine phosphatase, non-receptor type 11; protein tyrosine phosphatase, non-receptor type 11 (Noonan syndrome 1); protein tyrosine phosphatase, non-receptor type 11 S homeolog; protein-tyrosine phosphatase 1D; Protein-tyrosine phosphatase 2C; protein-tyrosine phosphatase SYP; PTP1C; PTP1D; PTP-1D; ptp-2; PTP2C; PTP-2C; Ptpn11; ptpn11.S; ptpn11-a; ptpn11-b; SAP-2; SH2 domain-containing protein tyrosine phosphatase-2; Shp2; shp-2; SHPTP2; SH-PTP2; SH-PTP2 protein tyrosine phosphatase non-receptor type 11; SH-PTP2 protein tyrosine phosphatase, non-receptor type 11; SH-PTP3; Syp; Tyrosine-protein phosphatase non-receptor type 11; XELAEV_18010676mg
Gene PTPN11
Product Type Antibody
Gene ID (Entrez) 19247, 25622, 5781
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human SHP2 (69-99aa EKFATLAELVQYYMEHHGQLKEKNGDVIELK).
Classification Monoclonal
Primary or Secondary Primary
Clone 2E6
5,767

Invitrogen™ IL-2 Monoclonal Antibody (JES6-5H4), PE, eBioscience™
GREENER_CHOICE

Rat Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Mouse
Host Species Rat
Conjugate PE
Applications Flow Cytometry
Form Liquid
Gene Accession No. P04351
Isotype IgG2b κ
Concentration 5 μL/Test
Antigen IL-2
Gene Symbols IL2
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias aldesleukin; cytokine; H-IL-2; il 2; Il2; Il-2; ILN; Interleukin; interleukin 2; interleukin 2 precursor; interleukin 2 variant IL2delta2; Interleukin2; Interleukin-2; interleukin-2 precursor; interleukin-2 precursor protein; interleukin-2; interleukin 2; Involved in regulation of T cell clonal expansion; involved in regulation of T-cell clonal expansion; lymphokine; M-IL-2; patial sequence of Interleukin-2; POIL2; porcine Interleukin 2; T cell growth factor; T-cell growth factor; T-cell growth factor (TCGF); TCGF
Gene IL2
Product Type Antibody
Gene ID (Entrez) 16183
Formulation PBS with BSA and 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone JES6-5H4
5,768

CD40 Monoclonal Antibody (5C3), Super Bright™ 645, eBioscience™, Invitrogen™
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Human
Host Species Mouse
Conjugate Super Bright 645
Applications Flow Cytometry
Form Liquid
Isotype IgG1 κ
Gene Accession No. P25942
Concentration 5 μL/Test
Antigen CD40
Gene Symbols CD40
Regulatory Status RUO
Purification Method Affinity chromatography
Gene CD40
Product Type Antibody
Gene ID (Entrez) 958
Classification Monoclonal
Primary or Secondary Primary
Clone 5C3
5,769

CD278 (ICOS) Monoclonal Antibody (7E.17G9), Super Bright™ 645, eBioscience™, Invitrogen™
GREENER_CHOICE

Rat Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Mouse
Host Species Rat
Conjugate Super Bright 645
Applications Flow Cytometry
Form Liquid
Isotype IgG2b κ
Gene Accession No. Q9WVS0
Concentration 0.2 mg/mL
Antigen CD278 (ICOS)
Regulatory Status RUO
Purification Method Affinity chromatography
Product Type Antibody
Gene ID (Entrez) 54167
Classification Monoclonal
Primary or Secondary Primary
Clone 7E.17G9
5,770

IL-23 p19 Monoclonal Antibody (G23-8), Functional Grade, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C
Target Species Mouse
Host Species Rat
Conjugate Functional Grade
Applications ELISA,Functional Assay,Neutralization,Western Blot
Form Liquid
Isotype IgG1 κ
Gene Accession No. Q9EQ14
Concentration 1 mg/mL
Antigen IL-23 p19
Regulatory Status RUO
Purification Method Affinity chromatography
Gene IL23A
Product Type Antibody
Gene ID (Entrez) 83430
Formulation PBS with no preservative; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone G23-8
5,771

CD62L (L-Selectin) Monoclonal Antibody (MEL-14), Alexa Fluor™ 700, eBioscience™, Invitrogen™
GREENER_CHOICE

Rat Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Mouse
Host Species Rat
Conjugate Alexa Fluor 700
Applications Flow Cytometry
Form Liquid
Isotype IgG2a κ
Gene Accession No. P18337
Concentration 0.2 mg/mL
Antigen CD62L (L-Selectin)
Gene Symbols SELL
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias A.11; AI528707; CD62 antigen-like family member L; CD62L; gp90-MEL; hLHRc; LAM1; LAM-1; LECAM1; LECAM-1; LEU8; Leu-8; Leukocyte adhesion molecule 1; leukocyte surface antigen Leu-8; Leukocyte-endothelial cell adhesion molecule 1; LNHR; LSEL; L-selectin; Ly22; Ly-22; LYAM1; Lyam-1; Ly-m22; Lymph node homing receptor; lymphocyte adhesion molecule 1; lymphocyte antigen 22; Lymphocyte surface MEL-14 antigen; pln homing receptor; PLNHR; SELE; selectin E (endothelial adhesion molecule 1); selectin L; selectin L (lymphocyte adhesion molecule 1); selectin, lymphocyte; Sell; TQ1
Gene SELL
Product Type Antibody
Gene ID (Entrez) 20343
Formulation PBS with 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone MEL-14
5,772

Invitrogen™ CD62P (P-Selectin) Monoclonal Antibody (Psel.KO2.3), Brilliant Violet™ 650, eBioscience™

Mouse Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Human,Mouse
Host Species Mouse
Conjugate Brilliant Violet 650
Applications Flow Cytometry
Form Liquid
Gene Accession No. P16109, Q01102
Isotype IgG1 κ
Concentration 0.2 mg/mL
Antigen CD62P (P-Selectin)
Gene Symbols SELP
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias CD62; CD62 antigen-like family member P; CD62P; CD62P antigen; CD62P; CD62 homolog; FLJ45155; GMP140; GMP-140; GMRP; Granule membrane protein 140; granule membrane protein 140kDa; granulocyte membrane protein; Grmp; LECAM3; leukocyte-endothelial cell adhesion molecule 3; PADGEM; Platelet activation dependent granule-external membrane protein; platelet alpha-granule membrane protein; PSEL; PSELECT; P-selectin; P-selectin precursor; RP1-86F14.2; selectin P; selectin P (granule membrane protein 140kDa, antigen CD62); selectin, platelet; Selp
Gene SELP
Product Type Antibody
Gene ID (Entrez) 20344, 6403
Formulation PBS with BSA and 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone Psel.KO2.3
5,773

Invitrogen™ NKCC1 Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

EDGE
Content And Storage -20°C or -80°C if preferred
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications ELISA,Western Blot,Immunocytochemistry,Western Blot
Form Liquid
Gene Accession No. P55011
Isotype IgG
Concentration 1 mg/mL
Antigen NKCC1
Gene Symbols SLC12A2
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias 9330166H04Rik; basolateral NaK(2Cl) cotransporter; basolateral Na-K-Cl symporter; BSC; BSC2; bumetanide-sensitive sodium-(potassium)-chloride cotransporter 1; Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 2; little ears; lte; mBSC2; Na-K-2Cl- cotransporter; Na-K-Cl cotransporter; NKCC1; PPP1R141; protein phosphatase 1, regulatory subunit 141; Slc12a2; slc12a4; sodium/potassium/chloride cotransporters; sodium/potassium/chloride transporters; solute carrier family 12 (potassium/chloride transporters), member 2; solute carrier family 12 (potassium/chloride transporters), member 4; solute carrier family 12 (sodium/potassium/chloride transporter), member 2; solute carrier family 12 (sodium/potassium/chloride transporters), member 2; solute carrier family 12 member 2; solute carrier family 12, member 2; sy-ns; zfnkcc1; zgc:85961; zmp:0000000537
Gene SLC12A2
Product Type Antibody
Gene ID (Entrez) 6558
Formulation PBS with 50% glycerol, 0.5% BSA and 0.02% sodium azide; pH 7.4
Immunogen Recombinant Human Solute carrier family 12 member 2 protein (110-282AA).
Classification Polyclonal
Primary or Secondary Primary
5,774

Invitrogen™ CCR8 Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

EDGE
Content And Storage Maintain refrigerated at 2-8°C for up to 3 months. For long term storage store at -20°C
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Form Liquid
Gene Accession No. P51685
Isotype IgG
Concentration 1.0 mg/mL
Antigen CCR8
Gene Symbols CCR8
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias C-C; CC chemokine receptor 8; CC chemokine receptor CHEMR1; C-C chemokine receptor type 8; C-C CKR-8; C-C motif chemokine receptor 8; CC-chemokine receptor chemr1; CC-CKR-8; CCR8; CCR-8; cd198; CDw198; chemokine (C-C motif) receptor 8; chemokine (C-C) receptor 8; chemokine (C-C) receptor-like 2; chemokine receptor-like 1; CKR-8; CKRL1; CKR-L1; Cmkbr8; CMKBRL2; CY6; GPRCY6; GPR-CY6; mCCR8; MGC129966; MGC129973; TER1
Gene CCR8
Product Type Antibody
Gene ID (Entrez) 1237
Formulation PBS with 0.02% sodium azide
Immunogen A 19 amino acid peptide near the center of human CCR8.
Classification Polyclonal
Primary or Secondary Primary
5,775

Invitrogen™ c-Jun Recombinant Rabbit Monoclonal Antibody (c-Jun-Clone 132)

Rabbit Recombinant Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Flow Cytometry,Western Blot
Form Liquid
Gene Accession No. P05412
Isotype IgG
Concentration 1 mg/mL
Antigen c-Jun
Gene Symbols JUN
Regulatory Status RUO
Purification Method Protein A
Gene Alias Activator protein 1; AH119; AP1; AP-1; Avian sarcoma virus 17 (v-jun) oncogene homolog; cjun; c-Jun; c-jun transcription factor; enhancer-binding protein AP1; I79_009953; immediate early; JUN; Jun A; Jun activation domain binding protein; Jun oncogene; jun proto-oncogene; Jun proto-oncogene, AP-1 transcription factor subunit; Junc; JUND; p39; proto-oncogene c-Jun; Rjg-9; transcription factor; transcription factor AP-1; V-jun avian sarcoma virus 17 oncogene homolog; v-jun sarcoma virus 17 oncogene homolog
Gene JUN
Product Type Antibody
Gene ID (Entrez) 3725
Formulation PBS with 0.09% sodium azide; pH 7.2-7.4
Immunogen Protein corresponding to human c-Jun [aa231-aa310].
Classification Recombinant Monoclonal
Primary or Secondary Primary
Clone c-Jun-Clone 132